dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_009329967.1.34863 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment MULTISPECIES: hypothetical protein [Bacillus]; AA=GCF_000603985.1; RF=na; TAX=1433291; STAX=1402; NAME=Bacillus licheniformis F2-1; strain=F2-1; AL=Scaffold; RT=Major
Sequence length 89
Sequence
MAEIKVKAEEVKTVFSSLQTKISALSISGSKADISNSSMDVVNKIKKIEKEYEQLLKKYK
EALSSVEKDAWSNIKVLIDTDKNISQKMK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

No Significant Domain Assignments. Without architecture containing the known domains, dcGO Predictor can not do anything. 1

Jump to [ Top · Protein sequence · Domain architecture ]