dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_009872881.1.37417 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment heavy metal translocating P-type ATPase [Chlamydia trachomatis]; AA=GCF_000318665.1; RF=na; TAX=1071760; STAX=813; NAME=Chlamydia trachomatis E/SotonE4; strain=E/SotonE4; AL=Chromosome; RT=Major
Sequence length 659
Sequence
MSPQLFSSPFSRELLSNFFESGMAEENSPLLSQKNRRLSQNLTLKSAYISLALYLGSLLS
HWIGYQALSSLLLILTFFLAGTPALIKSFEDILDRTVNIDILMTSAAFGSIFIGGALEGA
LLLVLFAISESLGAMVSGKAKSTLASLKHLAPTVAWVVQQDGSLQKVLVQNVKVGEIIRV
KSGEVVPLDGKIIQGASSINLMHLTGEKIPKSCGIGDTIPAGAHNLEGSFDLQVLRIGAE
STIAHIINLVVQAQSSKPKLQQRLDRYSSTYALTIFAISACIAIGGSLFTTLPFLGPDSA
FYRALAFLIAASPCALIIAIPIAYLSAINACAKHGVLLKGGVVLDRLVSCNSVVMDKTGT
LTTGDLTCSGCEDFGPESPLFYSCVLAMEQSSSHPIAQAIVNYLTEKQVQSLPATQCTTI
PGEGVSGEFNGEQAFVGRVSTALRYVPEEYREQLRERAQQAQERGDTCSIACLGKRVSLF
YFRDVPRHDAADIVSYLKKNGYPVCMLTGDHRISAENTARLLGIDEVFYDLTPDNKLSKI
QELAKSRQIMMIGDGINDAPALAQATVGIAMGEAGSATAIEAADVVLLNQGLSSLPWLID
KAKKTRRIVSQNLALALAIILFISGPASMGVIPLWLAVILHEGSTVIVGLNALRLLKNT

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]