dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_009873722.1.18643 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment transcription termination/antitermination protein NusG [Chlamydia trachomatis]; AA=GCF_000318925.1; RF=na; TAX=1071774; STAX=813; NAME=Chlamydia trachomatis L2b/UCH-2; strain=L2b/UCH-2; AL=Complete Genome; RT=Major
Sequence length 182
Sequence
MFKWYVVQVFTAQEKKVKKSLEDFKEASGMSDFIQQIILPSENVMEVKKGEHKIVEKYIW
PGYLLVKMHLTDESWSYVKKTQGVVEFLGGGAPVALSEEEIKNILADLEEKKSGVVQKHK
FEVGSQVKINDGVFVNFVGVVSEVFHDKGRLSVMVSIFGRETRVDDLEFWQVEEVVPGQE
SE

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]