dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_009990521.1.43719 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment cell division control protein Cdc6 [Sulfolobus solfataricus]; AA=GCF_900079115.1; RF=representative genome; TAX=2287; STAX=2287; NAME=Sulfolobus solfataricus; strain=P1; AL=Complete Genome; RT=Major
Sequence length 397
Sequence
MSDIIDEVISSFKTSSIFINREYLLPDYIPDELPHREDQIRKIASILAPLYREEKPNNIF
IYGLTGTGKTAVVKFVLSKLHKKFLGKFKHVYINTRQIDTPYRVLADLLESLDVKVPFTG
LSIAELYRRLVKAVRDYGSQVVIVLDEIDAFVKKYNDDILYKLSRINSEVNKSKISFIGI
TNDVKFVDLLDPRVKSSLSEEEIIFPPYNAEELEDILTKRAQMAFKPGVLPDNVIKLCAA
LAAREHGDARRALDLLRVSGEIAERMKDTKVKEEYVYMAKEEIERDRVRDIILTLPFHSK
LVLMAVVSISSEENVVSTTGAVYETYLNICKKLGVEAVTQRRVSDIINELDMVGILTAKV
VNRGRYGKTKEIGLAVDKNIIVRSLIESDSRFADLWS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]