dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_010872284.1.1889 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment protein IcfG [Synechocystis sp. PCC 6803]; AA=GCF_000340785.1; RF=na; TAX=1148; STAX=1148; NAME=Synechocystis sp. PCC 6803; strain=PCC 6803; AL=Complete Genome; RT=Major
Sequence length 634
Sequence
MKMKLIQPFIQSIRFRIVGLLLLCLIPPTLGGIFLIDSYTGRQLKKIAEQDLQSRARLII
QLISRSDRERQQSTAFVASQPAIVEFNVEASQYFLNEFIKFHQWNGFFVVANQEGELVAG
SDGANQEKGLPLKHWFEEVKDKNRHLNRLFPGKTYAESKDCLIVPIHSKNDQTQIGIVVE
CIPLPVIADFVQKILKDAELERILLVNYEGYIYADTDFKNYGVLENKKKSPLVNRLLNDQ
SGFVYSQGKFSYLSPVHLRGAKTWGLIVENSESDIQAAILNVNRIGYLLVLVIGGIVAYA
SWMVIHHSTVPILDLTKASQAIAAGDLDYEININQGNRQDEIGILGNSFIYMKNQIKTLI
AQEVKDGVNRLELEKGRQIQQNFLPISLPDLQQWQINAVFEPARSVSGDFYDAFLLGDDY
LAIVIGDVCDKGVGAAMFMGLFRSLLRVFSGETMPGDTCIRDVNYKCSANDGNGKKKVIV
QFLNAVRLTNDYIATEHGDMAMFATLFFGVIDISNGNLSYINAGHEPVFILNSEGIKHRL
KSTGPAVGMMPNSTFTIDSLKIDPGEMLIGYTDGVTDARSPTKEFFGRQRLMETLTANFS
AKTEILDIIKQELIGHIDGSIQFDDITMIAVYRN

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]