dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_010872848.1.47586 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment fused two-component system sensor histidine kinase/response regulator/phosphatase [Synechocystis sp. PCC 6803]; AA=GCF_001318385.1; RF=na; TAX=1148; STAX=1148; NAME=Synechocystis sp. PCC 6803; strain=PCC 6803 substr. GT-G; AL=Complete Genome; RT=Major
Sequence length 603
Sequence
MMNPSINSVDIESATAFIRHELRTPINAIVGYGEMVQEELAEANSPLTEEIDTLLVEAQK
LLEIINLFVKHSDGEDKSDFQKLFSTIPHSTNFSITNIILNCDSLLEAEECTNELELTED
IRKIKLAALRLQGLVNNIESIFTNFLESLNPGNGTGLSPDFIFPSSSNTNEISLGNIKTN
GVDSRELLKGKILVVDDNPSNLDLFFQHLTRKGHAVTTCLSAKDALGLLQSQNYDLILLD
LLMPETNGDQFLEYLKTSVEFQHIPVIIVSALDEFESIIRCIEMGAEDFLPKPFDPVLLK
ARIGSSLEKKRLRDQEKLYTQQVEGLSEMMAKELEKGRQMQKNFLPAHLLTRSGWEFSAY
FSPAQQLAGDFYDLFELPGDRLGIVVADVCDKGVGAALFMGLFRSLIRIFSGQAALDGLI
NPSFNLPSGQGLLDVNLDNLLNNINFEPLESIKLINNYVAINHGEASMFATIFFGILEPS
SGKLSYINGGHEPVFIVDSNHQLKTKLTSTGPAVGMLPDLQFKTAEIILQPGDLLLSYTD
GVTEAKSPTGNFFGKEKLLNALGSSFNSVDQLMLNIKESLEEHMGEAQQFDDITLLAIKF
QTT

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]