dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_010881821.1.38252 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment tRNA(Ile)-lysidine synthetase [Treponema pallidum]; AA=GCF_000813285.1; RF=na; TAX=1155776; STAX=160; NAME=Treponema pallidum subsp. endemicum str. Bosnia A; strain=Bosnia A; AL=Chromosome; RT=Major
Sequence length 477
Sequence
MSESRQKLHPLLVHVARSFGHFLVPRKPSCLLVAVSGGADSLALLYAAHELAPDFGVCAC
AVTVDHSLRAQEGALDARFVRALCARFSPPLPCFVQQISAGAVHACAKIRGRGVQDAARA
LRYKVFDHVAARCGAQVVLTAHTRDDQYETLLMRLFQGAAASALQGIRAARGRYVRPLLK
VSRTCVEDFLQTRGVRWREDASNTCRKYVRNRIRHELIPALDAVLAGWRSGLDKTFAGIS
AEHSFCVAALTRWREGCSHAWEPVPRALGTRLRMPRSDFLAAEFILRFFLLQEACVRLGV
SHRVPRGALERCARFDGVRRIHVSGLQLERAGAYVLFSCIHASDTARETKKQDAGSPPSS
EKQGVSAIYVARPGAYPCACGTLLVEVRPAGVFVCCAQDHVGVGPFSFPFYIRTHRTGDT
ISIRGGHKGIRKMFSEWHVPLSDRTVLPMIEQDGVLRALYGAALGYQNRYAERTPHE

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]