dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_010882480.1.43796 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment heavy metal translocating P-type ATPase [Treponema pallidum]; AA=GCF_001713235.1; RF=na; TAX=161; STAX=160; NAME=Treponema pallidum subsp. pallidum; strain=PT_SIF1252; AL=Chromosome; RT=Major
Sequence length 792
Sequence
MQVSFVVHGISCTACVRRIEEAVRHVTGAYDVYVNPTTSHLYVHTDLHPTEHTLFAQTII
DAVSHAGFKATLLDTHSTTAPLAATQPVHPDFVTLKRRVRTSLCLLVPLMYLSMGHMVHL
PIPGFLHPLKYALSFALVQAFLTLPVLYANRSLFRAGLIALYGAILRRNTATMDSLISLG
SLSSFTYGLFATARIAMGVHANDTALVSHYVADLYFESAAMIVTLVTVGKYLSALSKGRT
SRALTQLLDIKPKTARVIRQVSVPRGASPSSPTTASAASAHETHEIEIEIPAQDVLVGDT
VLVKAGELVPVDGIITSGQATLDESNVTGESIPVEKGRGDSVISASLVSTGFLKFRAERV
GEHTTLAQIISLVEKTAASKVPVTKLVDAVSAYFVPSIVALSLLSGCAWLCAGASAEFAF
SIAVTVLVISCPCVLGLAVPTALMVATGKGAQMGILIKSAQVFQQMARTKVIAFDKTGTL
TLGRPTLSHIHTLHPTYNEEDILHLAYSLEVCSGHPLAAAISVAAQRKGMTPLAITDFNS
EQGLGLRARLVHTSYAKTVMVGNARMMVAHSIDGMDTYLSPSHNLEETPLFVAADKNLVG
VLFVSDPVKVHSSAAIGALHKRGIQTLMLTGDVKHVAHTIAARCGVKKSKAELLPHDKER
EISALKASGMMVAMVGDGVNDAPALASADVGIAIGAGSDIAVESADVVLMRNCIRDVVTL
VDLSIATVRNMKQNLFWAFFYNTLGVPLAAGLGYPFFGLRLTPMLAAAAMSLSSVSVLCN
ALRLNQFQSSSP

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]