dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_010886278.1.38548 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein [Rickettsia prowazekii]; AA=GCF_000367405.1; RF=na; TAX=1290428; STAX=782; NAME=Rickettsia prowazekii str. Breinl; strain=Breinl; AL=Complete Genome; RT=Major
Sequence length 462
Sequence
MGDKMDSLLKNEVIKLFNDKPKSGIARIKKWCTDNNQDFIAETAKIFYEEKSNLNLEFVG
DYLGTDGVDNQKVLESFTKQFDFKEKDYLESLRRFLQSFKLPGEAQKIDRLVESFGTHYY
EQNLNIDINSKDAAYILAYQTIMLNTDLHNPSIAKSKKMTFEQLKNNLKGTNESKNFNDN
FLKKIYDEIEAKPFKLNFVDSSPGYQINNISSQNDKTFKQLNQFLEEKRNIQNIFPKLQN
NNLTIEFKNPKTFLSKFTGYKGSVIIKDEKSGAAEIQVYKPSIFSRWFLGEKSKIIIQPL
REEGRQPSEQSLKLAAQITASFETKVTSIKATYDYLKEDLKSQYDNIRNPKKELEKASAI
AEGHKNIKYITEIVHQINQPVKNAVAVFSSTISVEPQISKSDLPIKPPQLPVPKSIPNVV
KKAAKDISKQIPHERDKHKEELAKALEIQRRKIEKQNSGRVV

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]