dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_010927064.1.58338 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment MULTISPECIES: GntR family transcriptional regulator [Bordetella]; AA=GCF_000690315.1; RF=na; TAX=1331223; STAX=518; NAME=Bordetella bronchiseptica MBORD635; strain=MBORD635; AL=Contig; RT=Major
Sequence length 236
Sequence
MSSTKRPASRADEITQELVRMIQLADARRIAKLPTEMELAAQLGISRPVIRESLSRLESL
NMVTRRQGSGLYIVAPEKRSPEALVLLEQSAPLSPRSIAEAMSVRAILELETGRLAALNH
RQVDLDRMAAEIERLAATGARGLEAAEADEAFHRALSDAAGNVTLSQVLDLFLRLSWRRR
VEYFSQPKLGKQSIIEHQEILNAVASGDPDAVSTAIRTHLNSAERFWDSKYVKKKS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]