dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_010964616.1.48544 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein [Clostridium acetobutylicum]; AA=GCF_002216305.2; RF=na; TAX=1488; STAX=1488; NAME=Clostridium acetobutylicum; strain=ATCC 55025; AL=Scaffold; RT=Major
Sequence length 252
Sequence
MNNNVELAYLIQENYDLIKESKKILRDGSYIYLLKKLKSEFETAKKNYVNRKTELAKIKQ
SYSAISIELRKEREKMETNEYKLYNKAGSNLNMIEKLEGAIEIEKQNLKNLEDEAVDLLD
EEEKLKKEIEDLRLKLVNIKDNFYDYKEKSSEKVEKARQEMIAAKTKIEEIKSKIPKELF
EEISHLMSKSSCAVAKLNGEICGGCRMKVSSMTIDDLINNNSIVHCDNCGRILYYDESEG
KIKRKYKRKIRA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

No Significant Domain Assignments. Without architecture containing the known domains, dcGO Predictor can not do anything. 1

Jump to [ Top · Protein sequence · Domain architecture ]