dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_011243862.1.45845 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment MULTISPECIES: IscS subfamily cysteine desulfurase [Synechococcus]; AA=GCF_000817325.1; RF=na; TAX=1350461; STAX=1350461; NAME=Synechococcus sp. UTEX 2973; strain=UTEX 2973; AL=Complete Genome; RT=Major
Sequence length 388
Sequence
MSKDPIYLDYHATTPVDSRVVTAMQPFWGEQFGNPASRSHRYGLEAAAAVQVARETLATA
IAAQPEELIFCSGATEANNLAIKGVAETQHRKGQHLITVATEHQAVLSPCRYLESLGFQL
TVLPVNSQGLISVEQVAAALRPDTILVSVMAANNEIGVLQPIAAIGALCRDRGVVFHCDA
AQALGRIPFNVSDLNVDLLSLSGHKVYGPKGIGLLYRRSGVAIAPQLHGGSQEQGLRAGT
LAPALIVGFAQATELAIAEQPTETLRLQTLRDRLWQGLQAIGGLHLNGDPQQRLPSNLNF
SIEGIDPSRLIQRIRGAIAVSSGSACSSGNAEPSHVLTAIGRSPDLAHASLRIGLGRFTI
AEEIDRTLEILIAAIQAERSRLTRHKKG

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]