dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_011274372.1.57178 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment MULTISPECIES: 50S ribosomal protein L9 [Staphylococcus]; AA=GCF_001838685.1; RF=na; TAX=1608857; STAX=1608857; NAME=Staphylococcus sp. HMSC34B12; strain=HMSC34B12; AL=Scaffold; RT=Major
Sequence length 148
Sequence
MKVIFTQDVKGKGKKGEIKDVPVGYANNFLIKNNYAVEATPGNLKQLEQQNKRAEADRQK
EIDDAKALKSKLEEIEVEVSAKTGEGGKLFGSVSTKQIAEALKTQHDIKIDKRKMDLPQG
IHALGYTNVPVKLDKEVEGTIRVHTVEK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]