dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_011274372.1.67849 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment MULTISPECIES: 50S ribosomal protein L9 [Staphylococcus]; AA=GCF_001836805.1; RF=na; TAX=1715194; STAX=1715194; NAME=Staphylococcus sp. HMSC062A01; strain=HMSC062A01; AL=Scaffold; RT=Major
Sequence length 148
Sequence
MKVIFTQDVKGKGKKGEIKDVPVGYANNFLIKNNYAVEATPGNLKQLEQQNKRAEADRQK
EIDDAKALKSKLEEIEVEVSAKTGEGGKLFGSVSTKQIAEALKTQHDIKIDKRKMDLPQG
IHALGYTNVPVKLDKEVEGTIRVHTVEK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]