dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_011289987.1.28423 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment molecular chaperone DnaJ [Mycoplasma hyopneumoniae]; AA=GCF_000183185.1; RF=na; TAX=907287; STAX=2099; NAME=Mycoplasma hyopneumoniae 168; strain=168; AL=Complete Genome; RT=Major
Sequence length 374
Sequence
MAKQDFYKILGVEKSASLTEIKKAYRNLVNIYHPDKNTKKSAEEQKQAEAKFKEIQEAYE
ILSDETKRKQYDKFGHAAFDQQFGGGSSGFSGFDFGDIFSSFTSGFGFGGSQEQKYSRPL
KGENFQAKIYISFIESILGKEISQKLTKYDQCDNCKGSGANSSSDITTCYNCQGRGMQTE
VLNIPGFGRVQNKTTCSVCLGSGKNITKNCKKCRGKTIVETKEEVTIKIPAGIQDGMFIR
VAGFGGPGHKGGPSGDLHLEINVRQHKHFTRSGNDIHVNMPVSIIDIINQNTVEVPSPTG
LKKVKLYDYYKSGQIVNVLRAGAPDPKNPRIIGDLKVHLIFYIPEFSPRQKDELNQVFAQ
INDKTKAKWLKEFQ

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]