dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_011323720.1.57290 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment AsnC family transcriptional regulator [Natronomonas pharaonis]; AA=GCF_000026045.1; RF=representative genome; TAX=348780; STAX=2257; NAME=Natronomonas pharaonis DSM 2160; strain=Gabara; AL=Complete Genome; RT=Major
Sequence length 162
Sequence
MDRADELLELLCENARYSTADLARLTDSDEDEVEATIEELEAEGIIQGYTAVVDWDAAGD
ERVRAHVELNVTLDRETSYRDVAERLAGFSEIQDLRLVSGDYDFALEVEGENMREVSKFI
SDKVAPVPEITQTVTHYIMENYKQGGYRFDDDTDDDRLSVTP

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]