dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_011377878.1.95485 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment MULTISPECIES: tRNA lysidine(34) synthetase TilS [Synechococcus]; AA=GCF_000012525.1; RF=na; TAX=1140; STAX=32046; NAME=Synechococcus elongatus PCC 7942; strain=PCC 7942; AL=Complete Genome; RT=Major
Sequence length 336
Sequence
MLHRPLPSPSALSSDCWTPFHARLHQLLQRRSLLPTRSRLLLAVSGGQDSLALVQLLRGL
QPHWHWSLAIAHCDHGWRSDSTANAEHLRQLADQWQLPFYCQRSPEPPRSEAAARTWRYQ
VLEAIAADIDAALLVTGHTASDRAETLLYNLTRGSHLQGLASLRWQRSLSDRLTLVRPFL
GFTRAETSKMVQQFQLPVWEDSTNRDRRFARNRLRLEVLPQLRQINPQCDRHLANTAELL
ADEADWLAELTEQVYQQSLSEKGLCRSQLAQQPIALQRRVLHAFLQDQLQRSPSTVQVEE
LRQLITAPQGSCSSSLPQRRVAVVAGDWLRLQSVDD

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]