dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_011418758.1.90099 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein [Syntrophus aciditrophicus]; AA=GCF_000013405.1; RF=representative genome; TAX=56780; STAX=316277; NAME=Syntrophus aciditrophicus SB; strain=SB; AL=Complete Genome; RT=Major
Sequence length 769
Sequence
MKKSDTSHQMPMLSVIPTQIILLWIAFLIMIILPTPIQADMGRVVATEAQVSEDSQKAII
LHNREEEVLILGTDLKADKSARIIRFIPFPEEPKVQLASPASFESAMDLIKKHGLKFIEQ
TKGGRAAARAVEMRFNQRLGSHDVTVIRINDAAEFNGWVREFLRQKGLQLKREDPKIEAV
VRDYTRRGFVWFVFDFVTVNEQIRFVEPIQYRFKTKELYYPLKTSNTFGGSGMIDLILIT
PGTFCEPLQSYYGGCFGFQEMRATTSSQLENDEMKGIFPGIGQFSKNQNMFIQLMRYQGD
YEFDQDLLGDFGQAVPYAIGHVEEAWGSPWLFPMEENVKDLKERCRLKPDSGPCKAIFWR
YFFNPETQKCEKFVYGGCEGTVPFETKEECVALCEKDGGASSTLKNINFEEFTPSSKHFT
LQIPAGWPREEYDIQRSSLLSGNNKYELTVRAPGQEGLEYLSVRVAWHRDACGTPERFIY
DLLNPRFSSRRADAKVLPLTGPEAKTLEIKKVRQPFQGMNAKPVKAIERYVVIPAHTGFY
VLVYDAPEALFKENKWVFDKILSSFQPMVSLNSKPEPVAEVSDDEYEVYADFFSAEEVRG
FEIPPYFSNTYRARHVYHETSAGKNSDKQTLTHLMESFGALDKSIMEDYREKNKRVRILR
DRMVVPWLEILQTNEPNREGGRGMEQPLTVFPDEVFLSRIGFNEQKDTALFYVSQNGAPM
TGYFVLMVKKKNRWVIKNAVLEDFKIPYSEISPSFQYIQHDISDGKGGR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]