dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_011527003.1.91582 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment peptidase M24 [Lawsonia intracellularis]; AA=GCF_001975945.1; RF=na; TAX=29546; STAX=29546; NAME=Lawsonia intracellularis; strain=E40504; AL=Contig; RT=Major
Sequence length 299
Sequence
MFFGNYHIILLKEKNGTSKNLYIKGWLGSSLCIFLGVVIISNILLWQQYQNTNILQRQLS
ESERTIETQNTQLMGLVGKISSLQEDLSRVQRLDSKLRVIVNIEKDIEATSIGGSRTEEF
SRTYLPLHRQELMVRKLNNFLKQLSEEVRLEEVRQQELLQTLRDKKEALASIPSIWPISG
FITSHFGNRPSPFTGRIEYHKGLDISAAIGTPIQASGNGRVILAGCDGAYGNCVVLQHGS
GLTSRYAHMSTVDVKVGQNVRRGQIIGYVGSTGRSSGPHLHYEVKVNGMNVDPLRYILD

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]