dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_011749640.1.3707 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment MULTISPECIES: GntR family transcriptional regulator [Paracoccus]; AA=GCF_900115985.1; RF=na; TAX=266; STAX=266; NAME=Paracoccus denitrificans; strain=DSM 415; AL=Scaffold; RT=Major
Sequence length 223
Sequence
MDIEKQWPRGQRAAFVANFIRDQIVSGELAASTRINERVLTEQLGVSRTPLREAFKILES
EGLLTIEPNRGAMVTAISPQEVELAIEVLIALESVAAERACKHATDAQIDEIQALHDEMV
GAWKAGALMRYFHINQTIHQKIVDCAANPTLSRLYMAESQRIRRFRYAGNQISDRWARAV
YEHEQILDALRHRQGALLREVLRSHHLSGWRTTRAVLEGEIRL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]