dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_011819522.1.83733 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment IscS subfamily cysteine desulfurase [Prochlorococcus marinus]; AA=GCF_000015665.1; RF=representative genome; TAX=167542; STAX=1219; NAME=Prochlorococcus marinus str. MIT 9515; strain=MIT 9515; AL=Complete Genome; RT=Major
Sequence length 381
Sequence
MFSSPILLDYQSSTPCLEDVVNSMSPYWREIFANTSSKSNLAGINASAILEVSREKIQEY
LCLKKKKVIFTSGATESNNLALLGFARNFYKETKSYGHIITLKTEHKAVLEPLDQLRKEG
FHITAITPEKDGLISKEKFMSFIRDDTFLVSIMMANNEIGVIQPLKEISEICKSREIILH
SDYAQCLGSLELDNLDSVANMLTISSHKIYGPKGVGLLLIDRDIELQPLFFGGGQEFGLR
SGTLPLALIVGFTKAIEIAVFNQKKNAEKFLFYRDKLLHGLLVNNSGVEINGSMKERLPH
NLNLTVLDVNGSKLHKTLKSKIICSSGSACGNGEPSHVLLALGRSFKEAEASLRLSIGLM
TTSEDIENSIQIITDTINLLR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]