dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_012021823.1.31166 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment NADH-quinone oxidoreductase subunit C [Metallosphaera sedula]; AA=GCF_001266675.1; RF=na; TAX=43687; STAX=43687; NAME=Metallosphaera sedula; strain=ARS50-2; AL=Complete Genome; RT=Major
Sequence length 160
Sequence
MSEKPIDLVVKLLQERKIPLKVEGDTRGSIEVDKSKLVETAKVLKELGFDHVKAVTGIDY
PDQAKFQVVYHVSSFDLQLSKVIIALKTWTSYKEPVVPSLLSVWGSVWTGERETYEMLGI
TFEGNPDMRRLFLPEDFEGVYPLRKSFKVKTEGLFVDKSS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]