dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_012263848.1.4043 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein [Microcystis aeruginosa]; AA=GCF_000010625.1; RF=representative genome; TAX=449447; STAX=1126; NAME=Microcystis aeruginosa NIES-843; strain=NIES-843; AL=Complete Genome; RT=Major
Sequence length 1763
Sequence
MTSTLLPLLPAVDDVLFDFAQSDGFWANLETAFGTSYDVVKATELRQQWQSRDFSQLPEI
EVVNSSVLGSANGAYGISTNKIYLSESFFASASLDALVAVILEEIGHYVDAQINRVDTVG
DEGELFSHLVRGVNLTEAELTYIQTEDDRSVINLGGQFIGVEQTSPITLIVNTTIDENDG
SATIGSGLSLRDAVTIANKSPNTPYIIKLKSGTTYALTYVNNTTTGDRSLNTNGTITIET
DGTALASIVNNASPISGENDYNSIISNSSQLGVTLNNLYISNKAGRGIDNDYGGTLTLNN
STITGNTATYGGGIDNDGTLTLTNSTISGNTGGGIHNWGRGILTLTNSTITGNTATNFGG
GIENDGTLTLTNSTITGNTATYSGGGIYNWGRGTLTLTNSTISGNTATGYYGSGGGIYNS
TGTLTITDSAISGNTATGSGGGIENYGTLTLTDSTVSGNTAAYDGGGIDNYGGTLTLTNS
TISGNTATGSGGGIENYGTLTLTESTVSGNTAAYDGGGIDNDGGTLTLTNSTIFGNTATR
SGGGIFNSTGTLTITNSTITGNTADAGGGIYNGGTLTLTNNILTNNNANLGGGIYNRGTW
SSNSIISGHTANQVWYIDSDGDSTTSESSWINGQWIANPIDPKYPNIYDDATYTALPPTP
NPPPKPTISVSNARFDAPAGKVIFEVKLSSTYDKPITVDYYTLDGSANSIDPNQLKDFNN
VVKQTLSFFPGQTSKQIEITVLGSAPPTDQTFEILARDTAYRDWTDTDKGKEVDKIYDYS
DLGYEGYRINKVFKDSSTGFDAFGLTSDEKFFLVLANPLNANEFTSNSNNLLQDIANTSG
GNNTAAYTAGQNLINQLTSANQSYTFTDGTIYDLAKPPVLAIRGTEFSSGKDLLSDTETE
GVGYNQFTNNKAAINQWLSEVSNPVSGLTLKPNITGHSLGGALSQWVGGSYTGQLGKIVT
FNSPGISQQPGINFNATNNLGVTHYITSADVVSIAGSTYLNGLWNLEKYSKLTSAITFEK
HSVPVLNQTITRTNLSKPTDLTRKVANGNTTDLSSYWFTYLPDADYFALQMMIRGLGSLP
IPGIGLTGTYLAAALTYRGTTEKVRQAIGIAIDGLGNISDAVTSAYNAAKSWTSDAWDAI
IGQSDKKLGLSPSTANQSNSTQTLASSFLDTNSYQIATTATASQTIDNFWDAIPDWGDNA
WQATTKWSGDAWNSIDEWTPQTWQATTTWTAADWDKPFFTISNPTIVENNSGTNNLVFKV
TLSTTSTQTITVNYATADDTATAGSDYTATTGTLTFTPGQTSQDIIISVNGDTAIEPDET
FLINLSNPSNALITDNQGLGTITNDDGDNTSVTLAVSPSSVTEDGTANLVYTFTRTGVTT
NALTVNYTLGGTATLNTDYTRTGTNNTVTFAAGSDTATVTIDPTADTNVEDDETVTLNLA
PGTGYTIGTATAVTGTITNDDFSKLSINNVTVVEGKDNNAILTVTVNNPNPQPISVNYTT
APINAIANVDYTSKTGTITIAPNTSTATITIPILNDNLNEANETFAINLSNPVNATLSNN
KGIVTISDTLTANVTTTLPANVENLRLIGSNNINGTGNAGNNKITGNSGNNQINGRAGID
TLTGGLGADTFIFQFGQSTISTRDRITDFAINSDKIDLLTQAGNATSAPSNFSRAANSTV
TTLQNLINQVFTDANGATTGNQGLGVNSAALVQVTTGAIAGTYLVINDSTAGFQSSNDLL
INITGFTGTLPALGNIPVGNFFV

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]