dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_012498828.1.43748 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein [Chloroherpeton thalassium]; AA=GCF_000020525.1; RF=representative genome; TAX=517418; STAX=100716; NAME=Chloroherpeton thalassium ATCC 35110; strain=ATCC 35110; AL=Complete Genome; RT=Major
Sequence length 172
Sequence
MTSFEQILIAIQADILTRLGERLQPLPLALKRTADEVLLENETWTDADGLVIVRYAGSTY
GQVTAPGLTLQERELLFDVSVLCQNLTGENPEDLALGYVGQVITALAGFVPTDCTDALRV
VRDEFAQADAAAHKFHYRIRFACPALLIQTYDTEELHLLKTTDIQDLTIAST

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]