dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_012618824.1.75456 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment carbohydrate-binding protein [Methanosphaerula palustris]; AA=GCF_000021965.1; RF=representative genome; TAX=521011; STAX=475088; NAME=Methanosphaerula palustris E1-9c; strain=E1-9c; AL=Complete Genome; RT=Major
Sequence length 739
Sequence
MRRPSFLSCWPPIFSPKVIVTVNRHIFLSILSAALLLVSLGIGPVSAQTWQNETVDSAGQ
VGFFTSLALDSAGNPRISYFDDTDGNLKYAWHDGLGWHNETVDSEGRVGWYTSLALDSAG
NPRISYSDWSNNDLKYAWHDDSGWHTETVDSEGYVGAYTSLALDSAGNPRISYSDLSNND
LKYAWHDDSGWHNETVDSKGTVGWYTSLALDSAGNPRISYLYEGTDDLKYAWHDGSGWHN
ETVDSEGYVGKCTSLALDGAGNPRISYFDNTNNDLKYAWHNDSGWHTETVDSAEWVGWYT
SLALDSNGNPRISYFDDTNDDLKYAYYDSAGWHTETVDSAGEVGLYTSLALDGAGNPRIS
YLDFTHGDLKYAWVGTPLSGVCIVPGGTALPADTDGDGLYDDVNGDGVFNFADVALYFNQ
MEWISDNEPVAAFDYNGNGRVDFGDVIWLFNYLDAPIVSPTPTSTVAAFTLNKTMGAAPL
AVQFTSSDQCDLLNWTIQLGKTPIETRSGMNLTYVFSTAGTYTVQLKASNSTTGVISSAE
NTVTVTGTSTITTEQPYPTQHNVPGRVEAEDYDQGGEGIGYSDTTTPNEGGVYRTDSVDI
ESLPGASGYDVGWIRAGEFLTYSVDTTEAGTFDIGFCVANPGSTKTVIVYVNGAPRTLTI
PATGSWITWQTATLTGVSMNAGRNLIKVDMDNAASFNFDYMEFVVDYIASPTTTTPTPTD
TTLTPTQSPTDTTPTPILT

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]