dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_012875789.1.85100 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment 1-deoxy-D-xylulose-5-phosphate synthase [Thermobaculum terrenum]; AA=GCF_000025005.1; RF=representative genome; TAX=525904; STAX=166501; NAME=Thermobaculum terrenum ATCC BAA-798; strain=ATCC BAA-798; AL=Complete Genome; RT=Major
Sequence length 640
Sequence
MSRILDTIESPDQLKNLTHDQLKQLAQEMRERLVETVYGVTGGHFSSNLGTVEIAIALHT
VFDSPRDKIIWDVGHQAYPHKMLTGRNKLMHTIRQYGGLAPFLMREESPHDQFGAGHAST
SISAALGMAVARDMQGEDYHVVAVIGDGALTGGMALEALNNLGHLGTKMIVLLNDNEMSI
YPNVGVVPRLLTRLRTSRTYHRAKGDVVSILQRMPAGDALVELGKRFKDSVKELVIPNMM
WEELGLTYLGPIDGHNLADLQETLTLAKQLDRPVLIHAITIKGKGFEPAEAESKTHKWHS
VTPKSPGKSDNKPSAPRYQDVFAQTLIRLAEEDERIVGITAAMPDGTSLDQFGKRFPDRM
FDVGIAEQHAVTFAAGLAAAGMRPVAAIYSTFLQRAYDQVVHDVAMQNLPVVFAMDRAGI
AGNDGRTHHGALDISYLRCVPNMTLMAPKDENELQHMLKTALSLEGPAAIRYPRGNGYGV
PLSETFHVIPVGTWELLQEGEDLLILATGYSVYQALEAAKILSKQDGIFATVVNCRFIKP
LDEELLQKLVAKHDYLITVEENVRMGGFGSAVLESLADHSMVPSRFVRLGMPDRYVEHGS
QEILRKILGLDAEGIAQTARELLYKTTDLRDKTLKDVHQR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]