dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_012954581.1.87152 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment orotidine-5'-phosphate decarboxylase [Candidatus Atelocyanobacterium thalassa]; AA=GCF_000025125.1; RF=na; TAX=1453429; STAX=713887; NAME=Candidatus Atelocyanobacterium thalassa isolate ALOHA; strain=ALOHA; AL=Complete Genome; RT=Major
Sequence length 232
Sequence
MFSTNQIIVPLDVSDKKAVVNLLDKLPQVSFWKVGLEAFVALGPEIFSLLKDRQKKIFLD
LKFHDIPNTIAGACKSASNHGVDLITIHAAAGQKAMEAAAKAIASSSSTTKILAVTLLTS
LNSKELNCDLKISVELEQYALHMALLAQKLGIDGAVCSPHEVSQIRQLCGENFILVCPGV
RPSWSQVKDQKRIMQPKQALEAGADYLVIGRPITMADNPIEAWNRIINDITI

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]