dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_013143551.1.49614 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment VWA domain-containing protein [Staphylothermus hellenicus]; AA=GCF_000092465.1; RF=na; TAX=591019; STAX=84599; NAME=Staphylothermus hellenicus DSM 12710; strain=DSM 12710; AL=Complete Genome; RT=Major
Sequence length 313
Sequence
MIKLLHPEMINIILIIVPILMLLYIYVYSRRRNLLKLLDQRDNVLWHIIQASKIASITLL
LLASTLPVSVQTIQFTVHGNPEETEIRRVMYNITALHVLLIDESKSMQYTDGTNITRFVR
ALNFTYKYMNYLSPKDKLLIIGFSEYPRKICLGNTTFCRPKLLELEPNKKYTDLSAALAY
AYSYVTASQYPAIIVIVSDGAYNEGGDPYDEIVSINKSGYPVLFVRVGLDKRADQLIEEL
TASNIYVININQFTEKLLNKLTEDAARQMRLEAFVSKKLLEVKVSKEVIYPYPTVYLLVA
SLVLFLASRIEGY

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]