dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_013228372.1.79787 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment serpin family protein [Amycolatopsis mediterranei]; AA=GCF_000282715.1; RF=na; TAX=713604; STAX=33910; NAME=Amycolatopsis mediterranei S699; strain=S699; AL=Complete Genome; RT=Major
Sequence length 364
Sequence
MATDSHLRFALAVHSALGAGGGNTCFSPYSVASALTLAARAARGQTRDELVALLGDPGEQ
TVLLREAARLVEEAHSKDQPELAVANTLWADDRLPLEDSFKAELAEWPGAAVASAPFEKE
PEAARALINEDIGRTTRGLIPQLLPLGSIDSQVAAVLVNALYLKAAWKLPFREANTSDAP
FHAPSGTRDVPTMWLSESVGYAHTGGWQAVRLVAAGGLQAVVLLPDDDLAEAETRLDHAA
LTSLLGKIRAKKVELSLPKVSLDVSSKLAGVLRGLGVRTMFTDEADLSGLTPDPRLTVSE
VLHQAVLRVDEQGFEGAAATALIMRLTSMMIDDPVAVTVDRPFLLLVRHAGTGALYFIAR
VVEP

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]