dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_013705714.1.50338 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment histidinol-phosphatase [Desulfobacca acetoxidans]; AA=GCF_000195295.1; RF=representative genome; TAX=880072; STAX=60893; NAME=Desulfobacca acetoxidans DSM 11109; strain=DSM 11109; AL=Complete Genome; RT=Major
Sequence length 884
Sequence
MPLDKQAKPFFSHGSRWLRADFHLHTRADREFCYTGEDSYYFSSYIQGLKKTEIRIGVIT
NHNKFDLAEFNSLRQTAKRENIFLLPGVEHSVGDGANGIHTLIVFSDEWLENGQDYINQF
LNVAFQGRTPQEYENANGRSSLSLIDTIKKLEGYQRDFFLVFAHVEERSGLWHELDGGRM
QELGENEFFRRRSLAFQKVRTHDISDRKCRIKVRAWLGEAYPAEVEGSDCKSIDQIGQGG
CCYLKIGSFTFAAVKYALLDHANRLSGELNRHDSSHILSATFDGGVLDGKTIYFSPELNT
LIGIRGSGKSSILEAMRYGLDIPFGEKALDQDYKRFLVDHVLGSGGKVTIQAVDRRGQRY
EVRRICRERPDVYVEGILQPGISIRETILHKPIYFGQKDLSSTGEGFEKDLVEKLVGEKL
TGIRSKIEAQRQKVSDTINQLERLANVAEKKEEYESKKRDAEFRLKFYKDHGVEEKLQKQ
VDFDADSRKCHHVISLVKDYLAGLEEFINRYEDDLKNECIYTSRQNTVFFDAFFVNYKKL
IAGFLQIKEVLADGKKTLSELQEKFKEFEILKDGLKEEFAEIERKLFEEFKGSGAKAIRP
DEFRQLRKTVDQAKQMLEALNKQEDQRIIFNLELLQELATLNNLWLEEYQAVQAELGKVN
RSHSSLKIKAEFKGDKKAFAGFMKDVFGGSRIRQTTFENLAKEFTDFGAIFRELDKAKTI
IGNALVQVFEKYFTENLASLLTWQVPNRFVIKYRDKELKHHSLGQRASALILFILSQQDN
DLIIIDQPEDDLDNQTIYEDVIKLIRTLKPRTQFIFATHNANFPVLGDAEQIISCAYADD
SISITSGSIDCPDMQRKIVDIMEGGEEAFKQRKRIYEIWKPRSS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]