dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_013777050.1.74519 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pyruvate kinase [Acidianus hospitalis]; AA=GCF_000213215.1; RF=representative genome; TAX=933801; STAX=563177; NAME=Acidianus hospitalis W1; strain=W1; AL=Complete Genome; RT=Major
Sequence length 445
Sequence
MRKTKIIATLGPSSIDKVKELSQYVDIFRINFAHGDTKSHKEYFEKIKEYSDASILVDLP
GPKIRVGDIKGKIVLKPGDKVVFSPYEGIPVEDPLFYSGVKENSYVLIADGSIKINVTKV
EKDRVEGVVIEGGTVTSRKGINIPDIKIPSGVTDNDLQLLKEALDLGADFIGLSFVLSKD
DVLKVKGISKDRAWIIAKIEKKNAVENLKDIIKVADGVMVARGDLGVEIGLENLPFTQKK
IIRLSKLYGKPVILATQVLESMVNNPIPTRAEVIDISNSVSEGVDAIMLSDETAAGNYPV
EAVKTLHDIILAVEKRVKTVRPPPLTGDDAIAVASVNVAEISKAKLLVVHSRSGTSIIRI
SRLRPKVPIIGLSPNKELIRKLKICWGVYPFLTEKSLITLNDIIAYAEEISKKFAKCNEN
IVITGGDPTLEEGRTDFIKLHQIVC

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]