dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_013889689.1.34921 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment BspA family leucine-rich repeat surface protein [Helicobacter bizzozeronii]; AA=GCF_000237285.1; RF=representative genome; TAX=1002804; STAX=56877; NAME=Helicobacter bizzozeronii CIII-1; strain=CIII-1; AL=Chromosome; RT=Major
Sequence length 404
Sequence
MQEVLEKLEQEIKSVKRACRLGKSVLEEGLEVKTEAQELHAKFSALIEALTHASKAVDEH
YASLEDDTALEEMLILLKRVRARINTPLASLEQASTAKEALDSLASLEKSILDVEGVLAS
LKEHPTLSTPTSPKATPQMAKKYCPQSKEELKKLVADESVHLGEIDISKIADLSWVFCYA
DSILAAEPKVFRRANFEGLETWDTSHVTNMEYMFYRAIFFNYDISSWNVSRVQNMDSMFH
GCEIFNQPLSSWNVSRVEKMAGMFLGCENFNQPLNTWDVSRVEAMGWMFQHCEDFNQPLD
NWDVSRVENMNYMFHGCTSFDQPLKDWNVSRVEEMHSMFKDCKNFNQSLNDWDVSKVKSM
RHMFSNCYNFNQNLDSWHVLSTASTKSMFDGCTALKTLPTWYKN

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

No Significant Domain Assignments. Without architecture containing the known domains, dcGO Predictor can not do anything. 1

Jump to [ Top · Protein sequence · Domain architecture ]