dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_014035358.1.288 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment ribonucleoside-diphosphate reductase subunit alpha [Mycoplasma putrefaciens]; AA=GCF_000224105.1; RF=representative genome; TAX=743965; STAX=2123; NAME=Mycoplasma putrefaciens KS1; strain=KS1; AL=Complete Genome; RT=Major
Sequence length 719
Sequence
MKDSKELILDDSNDEYIKLNARSKIFAKGQDNFKLDVQAAKSYITNHIEPRLMQFDDLKQ
RIDYLVANEYYDKQILDKYQFEEITELDDYAKSFNHSFPSFMGALKFFNAYALKTFDGEK
YLETYTDRALMNALFLGNGSYQKAKNILKNIMLGRFQPATPTFLNAGKKHRGEYVSCYLL
RTEDNMESICRTISTSLQLSKRGGGVAVCLTNLRETGSPIKNIDGLSSGPIPVMKILEDS
FTYADQLGQRQGAGAVYISAHHPDIISFLDTKRENADEKIRIKSLSLGVVIPDITFELAR
ENKEMALFSPYDVQKVYGVALSDISITEKYYEMLENPNIKKTFISARKLFLTIAELHFES
GYPYLLFEDTVNRRNAHDKKGRIIMSNLCSEIVQVSTPSQYNQDLSFTKIGEDICCNLGS
LNIDKMMKAGKEFEEAVDISITALDVVSRNSDLDCAPSIKFGNANNHAVGLGAMNLHGFL
ATNAIMYDSPEAVDFTNIFFYTLAYNAFKASNRLAKEFGKFNSFDESRFADGSWFEKYTK
CQADKWTPATKKVEELFKHYQVEIPTQTQWIELVEEIKKTGLANSHLMAVAPTGSISYLS
SCTPSLQPVVSTVEVRKEGKLGRVYVPAYQINFDNMGYYAVGAYEMGPDPIINIAAAAQQ
HVDQAISLTLFMTDKATTRDLNRAYINAFKQGCASIYYVRIRQDVLEDSENYECDACKI

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]