dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_014178183.1.9551 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment serine/threonine protein kinase [Streptomyces bingchenggensis]; AA=GCF_002154605.1; RF=na; TAX=476552; STAX=476552; NAME=Streptomyces milbemycinicus; strain=NRRL 5739; AL=Scaffold; RT=Major
Sequence length 761
Sequence
MSLSTGDPDFIGGYTLVDRLGAGGMGVVYLGRSASGRHVAVKLVHQQYAQDEEFRTRFRQ
EVAAARKVSGAFTAPVVDADPDAERPWMATLYVPGPTLSEVVRKQGPLDGRSLRTLGLGL
VEALRDIHQVGVVHRDLKPSNILMADDGPRVIDFGISRAADNQTLTVTIGRVLGTPPFMS
PEQLRSPRGVTAASDVFSLGSLLVFAATGAAPFESDSPYVSGYQVMYEQPTLAGVPGPLT
AIAERCLAKEPTERPDLAELHRMLDALPDFAAAAPSTAEGPHAQGPHAQPHAQGPTHLGT
SAPKAPEALPAPPPGEPAAGRRRRRLILTVVGATLALAGLTVAAVMFATDSPSPGADADS
SSVRAAALPEGWRPWQASLRDTTPGPPLVYQQSGCVSDATTLYCGGTGFSVAAVDAATGH
VRWRYGDSPQQARPIGVRDGVLYVYQESEGNGRRVVALDADTKKQRWQQEISGSGSAALF
SGGVLTLSDGEREFIAYGTSGELLWRSPARAGAFCDPTVLGGVPYALCSSIDKNGLATEG
PYTLLRLDPADGTQRELATLPKKSLLLGAFHGQPLFLAPQTAKEVYDEGYVRPYNALIRV
DPRTGGTKRIALSHTMYGKATLLNGVVYFIETNGTISAVSADTGRRSWRRATDLESLSAP
VESKKYGRLYFCNRFGRLLALNTRTGEEAWRITALNDVGIGAVAVPPSVMLIKDAIVATA
GYTAFSVRPDRPSAWPSGQDSDKPSTQPSASGQVTSPGATG

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]