dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_014181224.1.69245 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment phosphotransferase family protein [Streptomyces bingchenggensis]; AA=GCF_000092385.1; RF=representative genome; TAX=749414; STAX=379067; NAME=Streptomyces bingchenggensis BCW-1; strain=BCW-1; AL=Complete Genome; RT=Major
Sequence length 348
Sequence
MTCSTPLADTTNPPGLELGALSRWFGANVPACQGPLAAAVLHGGRSNLTYLVTDGHSRWV
VRRPPLGGLTPSAHDIGREFRVMSALRATGVAVPGTVAHCTDQDVTGAPFTVVAYVEGRV
LRSRADTAGLTPYDLGRCADGLVEQLARLHALSYTEAGLSGWGRPEGYLRRQLDRWRTQW
DLVATRQLSELPRLHKALEDALPRESDASIVHGDFRVDNTILDPTDLSRVRAVVDWELST
LGDPLADLGTFLAYRDPAVDALLDSPAATDPGFPGPFELAELYALLSGRDITLLPFYQAL
AYFKIAVIAEGVYARHLQGVTVGEGFAGAGASVPELVKAGLALLGRRR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]