dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_014256134.1.34793 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment glycoside hydrolase [[Clostridium] clariflavum]; AA=GCF_000237085.1; RF=representative genome; TAX=720554; STAX=288965; NAME=[Clostridium] clariflavum DSM 19732; strain=DSM 19732; AL=Complete Genome; RT=Major
Sequence length 609
Sequence
MKKRLVKICVLVMVTAALVCCTINFSAEIILAVDFNTMLDGYNSMGTMQLLSTDSETSKI
RLQSYNYPSMYIRHNNFIARIDEKVSPEEDAQWRLVKGLANQGEGYVSIESVNYPGYYLR
HYDYKLRLEKNDGSSIFAADATFKVVQGLADTSCISFQSYNYPTRYIRHYEKLLRIDEIV
TDLDRMDATYRLFDDSVVLPDPNEPEGAVIVTNPVVIQRADPWVYRHTDGYYYMTASVPE
YDRIELRRAKTIQGLASATPKTIWRRPSSGVMGGHIWAPEIHFIEGKWYIYFSAGTSSNK
FDIRLYVLECADSNPIDGTWIERGQLKTNWESFTLDATTFEHNGVRYLVWAQKDPNIDSN
SNIYIAKMNGPFAITGKQVMISTPEYPWEKVGYKVNEGPAVIKKNGRIFITYSASATDSN
YCMGLLTASDTSNLLDPNSWKKSPSPVFQSNDSTGQYGPGHNSFTTSPDGKVDIMIYHAR
NYKNIIGDPLYDPNRHTRAQRVDWNDDGTPNFGIPVADGRIEIYIPPTDIPDPINFIYGD
LNGDKAVNAIDYALMKRILLGMSGELLSDDWEKAADLNMDGSINSIDFALLKKYLLGMLK
TLPYTNTAL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]