dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_014377111.1.69969 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment GntR family transcriptional regulator [Blastococcus saxobsidens]; AA=GCF_000284015.1; RF=representative genome; TAX=1146883; STAX=138336; NAME=Blastococcus saxobsidens DD2; strain=DD2; AL=Complete Genome; RT=Major
Sequence length 234
Sequence
MAECPGDDRAFMTKGDVAYARIRTLILSGELAAGAVLPQAALARTIGMSTTPLREALRRL
KQEGLVELDAHRDARVRPLDATEARDLLELRSALDPLAASLAAHRRTDADLAEIAAALAG
LEALTTHPSAAQLESHHRFHAAVHRASHNALLVQTLDGLWVKTDRYRRHALEVGRSEADR
HARATEHRLVLEAVRDRDAEAAAERMRRHVETSLGARSADRLADEGAGTDRSTT

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]