dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_014379987.1.3602 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment copper-translocating P-type ATPase [Mycobacterium intracellulare]; AA=GCF_000277125.1; RF=representative genome; TAX=487521; STAX=1767; NAME=Mycobacterium intracellulare ATCC 13950; strain=ATCC 13950; AL=Complete Genome; RT=Major
Sequence length 751
Sequence
MTVVDDAVLPVVSDAGGRMRVVVPWVRANSRRAVAVEESVGRQHGVRAVHAYPHTGSVVV
WYSPRRCDRSAVLRAITEAAHIAENLIPARSPRSADVRNTEVLRMVIGGAALALLGVRRY
GFKRPPLLSPTGQLVATGVTIFTGYPFLRGALRSLRSGRAGTDALVAAATVASLVLRENV
VALTVLWLLNIGEYLQDLTVRRTRRAISELLRGTADTAWIRLNDGSEVQVSIDTVEIGDQ
VVVHDHVAIPVDGEVIDGEAIVDQSAITGENLPVSITAGSPVHAGSVVVRGRLVVRASAV
GSQTVIGRIITRVEEAQLDRAPIQTVGENFSRRFVPASFILSALTLVLTGDVRRAMTMLL
IACPCAVGLSTPTAISAAIGNGARRGILIKGGSHLERAGRVDAMVFDKTGTLTVGRPVVT
NIIALHKDWEPEQVLAYAASSEIHSRHPLAEAVIRSTEERRITIPPHEECEVLVGLGMRT
WADGRILLLGSPSLLRDERVRISKKATEWVDTLRRQAETPLLLAVDGKLVGLISLRDEVR
PEAAEVLKRLRATGIRRIVMLTGDHPETAAAVANELGIEEWRAEVLPDDKLEVVKALQDE
GYVVGMVGDGVNDAPALATADIGIAMGLAGTDVAVETADVALANDNLQRLLDVPDLGARA
VEVIRQNYGMSIAVNAAGLLIGAGGALSPVLAAILHNASSVAVATNSSRLIRYRLSDTAL
GNAGDRDTNTEGSLPLPGGSVRPLVAQESSR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]