dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_014410667.1.49683 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment DNA polymerase III subunit beta [Rickettsia parkeri]; AA=GCF_000284195.1; RF=na; TAX=1105108; STAX=35792; NAME=Rickettsia parkeri str. Portsmouth; strain=Portsmouth; AL=Complete Genome; RT=Major
Sequence length 379
Sequence
MLKLIVETKTLVQSLGFASSVVEKRNVIPEYANIKLSAKDGNLELSSTNMDLYLSQKIAV
QVVSEGECTVSTKTLNDIVRKLPDSELTLTDLGTTGLEIKGKNCKFNLFTLPVSSFPAMD
SINPEASFKISCTDFAKIIESTKFSISLDETRYNLNGVYLHIKDKEFCSASTDGHRLSIS
WVTLEKQIKNFGVILPQKSAEEILKIVKDPKNINEDIEILLSSNKIKFICNENTSMLSKL
IDGTFPDYSTFIPESSSSKLVINRKMFADSIERIAIITVEKFRAVKLSLSRETLEISAVG
EARGNAKEVINSSQDKESFYEYNSDESLAIGFNPQYLEDVLKALKSDVVELYFSDVSAPV
LIKFPENPKDIFVVMPVKV

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]