dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_014410990.1.24793 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment toxin-antitoxin system HicB family antitoxin [Rickettsia parkeri]; AA=GCF_000965085.1; RF=na; TAX=1359203; STAX=35792; NAME=Rickettsia parkeri str. Grand Bay; strain=Grand Bay; AL=Contig; RT=Major
Sequence length 114
Sequence
MKTNDTFDGFTIELFKDTDGDWLARFEELPNVSAFGNSPEKALQELQQAWTLMKASYISH
NQSIPLAPSRKEYSGQFNVRVDKRVHRALVLEALRAKISLNALVSQKLTLSVKQ

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]