dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_014493792.1.77977 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment serine--glyoxylate aminotransferase [Bradyrhizobium japonicum]; AA=GCF_000284375.1; RF=representative genome; TAX=1037409; STAX=375; NAME=Bradyrhizobium japonicum USDA 6; strain=USDA 6; AL=Complete Genome; RT=Major
Sequence length 400
Sequence
MHQGRHFLQIPGPSPVPERVLRAMDMPVIDHRSAEFGELGRAVLEGSQTIFQTAGPVVIF
PSSGTGAWEAAIVNTLSPGDKVLMVETGHFATLWRQMAGRFGIEVDFVPGDWRRGADPAL
IEAKLTDDKARAIKAVMVVHNETSTGATSRIAEIRAAIDRTAHPALLMVDTISSLGSVDY
RHDEWKVDVSVSCSQKGFMLPPGLGFNAISEKARAAAKTNKMPRSYFDWEEMLKPNANGF
FPYTPATNLLYGLREAIAMLLEEGLDNVFARHQRLAAATRAAVSHWGLEILCQEPSEFSP
VLTAVLMPPGHDADQFRKIVLDNYNMSLGSGLSKVAGKVFRIGHLGECNALTLLGALTGV
EMGLSVAGVPHRSGGVDAAMKLLEQRPQGNASPHLKVVGT

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]