dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_014496551.1.97209 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment threonine-phosphate decarboxylase [Bradyrhizobium japonicum]; AA=GCF_000807315.1; RF=na; TAX=375; STAX=375; NAME=Bradyrhizobium japonicum; strain=E109; AL=Complete Genome; RT=Major
Sequence length 321
Sequence
MREHGGNLDLAQQRFGGRAEDWIDLSTGINRLPYPVGEVSARAWNALPSRAEIESLHQAA
QHAYRTSAPIVAMGGAQAAIQLLPQLAPRGRARILAPTYNEYAGVLSTAGWDVQEVGELD
ALAGADLAVVVNPNNPDGRRFAPQDLLALLPRVGRLVIDESFADAAPLLSLASEADRPGL
LVLRSFGKFYGLAGLRLGFALGHAADIAKLGAASGPWPVSGAAIAIGCRALRDDHWAEAT
SARLARDCARLDDIVRSLGWRLVGGAPLFRLYETPDALAAQEKLARSQIWSRVFAREPAW
LRLGLPGSEAEWTRLAEALAR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]