dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_014570196.1.101629 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment heavy metal translocating P-type ATPase [Lactobacillus rhamnosus]; AA=GCF_000026505.1; RF=representative genome; TAX=568703; STAX=47715; NAME=Lactobacillus rhamnosus GG; strain=GG (ATCC 53103); AL=Complete Genome; RT=Major
Sequence length 608
Sequence
MKKNWQLMMVLVVSAVALVFAFILKQPLIAQGLITVMGSIIALIMFGGMVKTIRSGNFGV
DLLAITAVVATLAVSQYWAAMIVLLMLTGGDALESYAATKASSELKQLLENAPTTAHRLV
DGHVEDVDVDAVQVGETILVKPQEVVPVDGTVLEGESLVDEASLTGESKPVAKNAGSDIM
SGTINGDSALTVKVTQRAEDSQYQGIIKLVKESEARPAHFVRMADRYAVPFTLVAYVIAG
LGWFLSGDPVRFAQVLVVASPCPLILAAPIAMVSGMSRNSRNGIIVKSGTTLEKLSDART
FAFDKTGTVTRGILKVATVLPQAGFSQDELLNLAASAEGQSTHILARSLTDAVPAADRLP
ASEVSEATSFGVYATVDGHKVKVGKAEFADAKDTLDTTAVYVNVDGQYAGAITFSDQIRP
EAKETMTKLHELNDANLIMISGDQQSIADKVAQEVGIDQVYAEQLPQQKIEVLDNVPKDD
RPVVMVGDGVNDAPSLAIADVGIAMGAHGATAASESADAVVLRDDLAKVAAATLIAKETM
VIAKQSVLIGIAICTGLMLIASFGVIPTIIGAMLQEVVDTVTILYALRARNGLHRQALVD
PVRAEARA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]