dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_014579833.1.62369 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment cell division protein FtsZ [Mycoplasma hyopneumoniae]; AA=GCF_000400855.1; RF=na; TAX=1116211; STAX=2099; NAME=Mycoplasma hyopneumoniae 168-L; strain=168-L; AL=Complete Genome; RT=Major
Sequence length 327
Sequence
MEKCSKIMLMGLGDFGSKIVESINFDQASFPKFFINSADEYTNSNFLNRQNSLIIPQSNF
RYNWQKANRAILDKSLEIKLALVNIRILFLIVGLGGATGSGFSLAIANIAQKMGIIVIVI
ATNPLENESKIRQQTSFDVLSELKKVVDSLIIISNEQISENYSGFFLENIFKLITTNIQA
KIGIILKAFCQNNALVHVNNSISESILANNNFVFVTSAIAKGENRGIIATKKALKNHFVE
FDLFAAEEMLVTITADNSILQAEISDILNIIRKNFNQDLKFSYGLYQNPQLGNQVEIGII
ASQKKHSYESKKAAKLNLAFDNEFNIF

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]