dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_014600186.1.91857 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment tenascin-R TN-R; restriction; flags: Precursor [Paenibacillus polymyxa]; AA=GCF_000237325.1; RF=na; TAX=1052684; STAX=1406; NAME=Paenibacillus polymyxa M1; strain=M1; AL=Complete Genome; RT=Major
Sequence length 1039
Sequence
MKIKKHLSTLLVTSLLVGGFIGFGIKTEASGSFNTKYQLLSPGEVNLYWDQQPISGNYWI
YRDNVLLGKVPAGYVPSFWDEEATPGTHVYRIDAIDTVTGTKLIDSESITVNTKEADEAL
PTSFKIGNRTASVNASFVKIGGVVFRPLADNYLISSKAVVESNWLPSNWKKNDFSNSGLD
KKIENTWLPTLNDTEYESLKVTSYSAPGWEGNLITNPIVDERAVPPTMKELLKYSSLYDI
PTENLNAGQFVRDKMFNNSITYVYGSSDNIHKIRVHRSTSSSFPTALVITLKSSTKLSGE
GTSRNPYTISSVGPENPSLQTPNGLKLVSSKAGHTSFSWDIVEKATSYIVKRDGIDIGTV
STTVFEDSSTVAGSSYNYTITAKGTDGSSSQESASLKIDVQAPPVLKAPANFKELGKTHN
SVLLGWDAVVGATSYQLTSDGSVAYEGSNTQINISSLSPGDYTFKVKAISDGISGPESIV
KVSIKENTLDYPIGLSVTNATYNTISLKWNSVNGAESYIIQRDGVEVGRTTNTNFSDENV
QPGAQYDYGVMAINGSIKSENSKLTVTVPTKPIEGLAPGIPSGFKVTRAYADKVKLQWAT
VSDATYYDLIRDSGTLVYRGPLTAITDETTGPEESYTYHIIAANQFGKSLPSSTIAVTTP
AEAPAIVVSPSPVVEGTITFKFNMVEGAQSYKVERNPEVTYDNNGNGTFHLTYFNTVTGE
TRDYGNVTPIDNKLPFYETGVDPGKDYHYEITAIRMSSLGIPEVIGKSEVSINTPSDGSG
VTIPAEEDSTQDKPGDKSKSKKNKDSHEDVISNNSTGKAITGSSGSTLSSVKNSISPDSS
KRFAEITNAPQSTVSESTYMFTDLTGNFAEQAVYSLAKHGTIIGYEDGTFGPDKKISRAE
FAIMLTRAMKYSSDEGYVNNFKDFDMNTWYSKELAVALNNKVTKGFDKDTYKPNSLIPRE
QAAVMVANIMRTKMADNGNEILYTDKNNIIDWARSDVLFTSSLDIFNGYSDGTFLPKRQI
TRAEAAVVIYRMLSKINNK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]