dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_014676890.1.57224 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment transcriptional regulator [Streptomyces hygroscopicus]; AA=GCF_000340845.1; RF=na; TAX=1203460; STAX=1912; NAME=Streptomyces hygroscopicus subsp. jinggangensis TL01; AL=Complete Genome; RT=Major
Sequence length 915
Sequence
MAGSGGPLSRSGLRGREAELEVLRTLIDAVARTGSGALAVLRGEPGIGKTTLLTEVVTGA
EAAGFSVGYGKADELHHLVPLSSLATCVLHGDRPLLSGDALVDLAHRHDQRIWLVERLAE
AIEDRAGGAPVLIALDDVQWADPLSRFALQQLPSRLRTSPVLWLLTERQGVGGPAEEIVA
AVADELPVRTVSLGPLSGAAIGQLAGDTLGAAVDERVRELLAGAGGNPFLAVEMLAGLRT
TDASGEPVPPGLVVGVRGRLGSLHPDTLRFLQMGSVLGRRFGFQDAAALCGRPSVALLPA
LEEALRAGLLEDDGDQLVFRHDLLRQAVYVDIPPSARKVLHREAAGRLVAAGHQPIDVVS
HILRGAQPGDEEAVALLRRAAADVLPVTPGLAADLMTRALDLVPVARPLWFAVGEQAIVS
LTRAGRNREALATGDRLLACRPPMETFGRLHAALGGTLWNLDLADELRRRAEAALAVGGA
APEVEARLAGLRALALSRAHDLAPARQAGEDALRAAVVTGDREAHVQALFALGEIALNAG
ENALALKRFTALSAVDPTFFPEEIVAYQHMDDFDTSERLLAKAADESGGIREGMLLWAQG
QQHLELGRLDDAEADFVTMERLEDEVQAHVQQVNGRVIRSRIALLRGDREAARQHLAEAR
QRLAVKPNPGNTAAVRFLEAVHAEVDGDAERAVDRVRQVQREGPFLRWRLLRTWVGTAIR
VALRGADRALAEDLASQAEAHAARNPAVPTATGLAARARGLVCDDPVLLERSVVLLRHSP
RPLVRAAASADLGRALLATGRRTEAVAALTKAQAAFAASGAHAAAAHVQRDLRRAGAGGR
RTADEQRPVQGWEALTVSEKKVARLIAEGHSNRTAAELLVVSPHTVNTHLTSAFRKLSVN
SRVQLANLVMALPDE

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]