dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_014737566.1.39459 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment NADH-quinone oxidoreductase subunit D [Thermogladius calderae]; AA=GCF_000264495.1; RF=representative genome; TAX=1184251; STAX=1200300; NAME=Thermogladius calderae 1633; strain=1633; AL=Complete Genome; RT=Major
Sequence length 538
Sequence
MGGKLIQEKTKVSRDALLDSIRLFMEQGFSNIVAITGVDRKDNIELIYHLGDEHGGMVHL
SVQLPKGDPVVDDISSLKPGAKILEREVHDLFGVEFWGFDELDKKRLLLPECYPEKASPP
LLKDVDSDTFKKYIGDPMACAYEALTLSAPLSPESALVPIGPYHPALKEPEFFSLVVEGE
RIKKAFVRIGFVHRGIEKLAESRTYIKDIFLFERVCGICSTHHAWTFVEAVEKLLNVDPP
PRAQYLRTLIAELERIHSHSLWLGLIGYWIGFESMFMWVWGLRETVMDLFEELTGNRVHK
SFITIGGVRMDISDEKVKKAAAKVSEFEKQIDSVMETVMSSDLFIERSKGIAKYTLEEAR
AFSAVGPVRRAAGDPYDIRRIEPYGAYGELDFEVRTTKTGDVYNLVLLRLGEIKESARII
RQIAEKIPSGNPVPPKPFLGVVKEGEAYARTEAPRGELFYYVNSNNTAYPYRVKVRTPTL
LNIQLAAHLLEGATLSDFPVIVTSIDPCFSCMDRVLVYDERAGCAKIISAEEIGRKRM

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]