dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_014768164.1.2099 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment elongation factor EF-2 [Desulfurococcus amylolyticus]; AA=GCF_000231015.2; RF=na; TAX=768672; STAX=94694; NAME=Desulfurococcus amylolyticus DSM 16532; strain=DSM 16532; AL=Complete Genome; RT=Major
Sequence length 736
Sequence
MVKFKQTSEVLKIMGNIEQIRNIGITAHVDHGKTTLSDSLLSAAGLISEKIAGQALALDY
LDVEQKRQMTVKAANASLYHEYKGKPYLINLIDTPGHVDFQSKTIRALRVIDGAIVVVDA
VEGVMTQTEMYLRVALEERVRPVLFINKIDRLIKELRLSPTEIQQRLVQIVRDVNTLIAT
YADKEFQKAWLLDPMKGQVAFGSARDRWGLTIPLVQQKGIKFSDIVDVYTRGKEAVAELQ
KTAPLHEAILDMVVKHVPNPREAQRYRIPKIWHGDLNHEIVKYLIEADPNGPLVMLINDI
RVDPHAGLVATGRIYSGTLRPGEEVWLVNARVPQRVLQVSLYMGPYRELADEITAGNIAA
ALGLEKARSGETVVSMKYKDTMTPFEKLKMITESVVTVAIEPKNPQQTTKLIDALYKLHL
EDPSLIVKINEETGEYLLSGVGTLHIEIALTLLKDLYGLEVVTSPPVIVYRETIRDRSQV
FEGKSPNKHNKFYISVAPLNEETLRLLSEGIIMEDMDARERAKILREQAGWDADEARRIM
AIDENLNILIDMTTGVQYLREVKDTIIQGFRLAMREGPLAMEPVRGVKVVLHDAVIHEDP
AHRGPAQIFPAVRNAIFAGFLTARPTILEPILKLDIRSPMEYIGNISSVITKKRGKLIEV
QQMETTARVIAEIPVSESFDIADMLRNVTAGKAIWGQEFSRWAPVPENMLMDLIAKIRTR
KGLKPEPPKPEDFLSP

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]