dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_014866379.1.51038 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment C4-dicarboxylate transport sensor protein dctS [Methanoculleus bourgensis]; AA=GCF_000304355.2; RF=representative genome; TAX=1201294; STAX=83986; NAME=Methanoculleus bourgensis MS2; strain=MS2T; AL=Complete Genome; RT=Major
Sequence length 787
Sequence
MSGSLRVLLIGASPGDVLGIQEMLRGCGREIELIHCERLEDGLALASGGAVEVVLLDLDL
PENQATTCLDRLRRTAPDVPIIVLTAEGDDRAALRAMQHGAQDYLARERIDAELLCRSIK
YALERTRAELALRHSEAMYRRLVENLNEGVLAVDEAGLITFANPRMGEILGYPAGRLIGL
PISVFFDTADGAVSGTRNPFCRQTDRRQEFELDLLASDGRRVHVLVVTSPVTDAAGAFGG
CLAGVLDITDRKEAELALRQSEQKYRLVVESLSEGIWVIDQDARTLFVNPRMAEMLGYAP
EGMIGRQFYSFIPPSCSATIQDRLTRRRDGIREQYECEFIRKEGDRITALLIASPFMDDS
GEFRGSIAGVMDITERKRAEEEIRIRSEQLMVLNRIISVSATSLSLAEHLEESLEKTLEL
MGFHVGIVYMLDADRKRALLQYQRGVPPSCMPRNRVVKIHHWPFNFIFVAGQPRYIERHP
DLNSIEAGILRELDVSALACIPLIAEAVVVGAVYAGSRTKESFSREERTLLETIGKEIGS
GILKGMLHKRLEAANREANLYLDIMTHDIRNTENVSGLYAGLLIEMLEGEAALYARKIES
GVRRSKEILGNVSTIRRIHHESPDLSPVDLDVVVKEEVAAFPDVAIEVEGMSRQVWADDL
LPEVFTNLIRNAVRLGGPGIEIAIRVEDYDGESVLVSVEDTGPGIPDPLKGSILHLFERG
WIEGCGDGLGLFIVRTLVERYGGTLRVEDRVEGRPDLGAAFRFTLREVLSSGSDEDSDRC
PVGEECE

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]