dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_014868464.1.88179 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment MULTISPECIES: MarR family transcriptional regulator [Methanoculleus]; AA=GCF_900079125.1; RF=na; TAX=83986; STAX=83986; NAME=Methanoculleus bourgensis; AL=Complete Genome; RT=Major
Sequence length 77
Sequence
MDEVNLPPSSRKILGLLEDGGALTHKELVRLSNLAPRTVRYALKRLKDNDMIVEKFNFRD
ARQILYEYKDSQMVSTP

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]